PDB entry 1qkl

View 1qkl on RCSB PDB site
Description: hRPABC14.4, essential subunit of human RNA polymerases I, II and III
Class: RNA polymerase
Keywords: RNA polymerase, transcription
Deposited on 1999-07-26, released 1999-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II 14.4 kd polypeptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qkla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qklA (A:)
    msdnednfdgddfddveedeglddlenaeeegqenveilpsgerpqanqkrittpymtky
    erarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirrylpdgsyedwgv
    deliitd