PDB entry 1qkl

View 1qkl on RCSB PDB site
Description: hrpabc14.4, essential subunit of human RNA polymerases I, II and III
Class: RNA polymerase
Keywords: RNA polymerase, transcription
Deposited on 1999-07-26, released 1999-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II 14.4 kd polypeptide
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qkla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qklA (A:)
    msdnednfdgddfddveedeglddlenaeeegqenveilpsgerpqanqkrittpymtky
    erarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirrylpdgsyedwgv
    deliitd