PDB entry 1qkk

View 1qkk on RCSB PDB site
Description: crystal structure of the receiver domain and linker region of dctd from sinorhizobium meliloti
Class: transcriptional regulatory protein
Keywords: transcriptional regulatory protein, receiver domain, 2-component signal transduction, sigma-54 dependent transcriptional activator, bacterial enhancer binding protein, high solvent content crystal
Deposited on 1999-07-23, released 2000-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.218
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c4-dicarboxylate transport transcriptional regulatory protein
    Species: SINORHIZOBIUM MELILOTI [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13632 (Start-141)
      • variant (41)
      • variant (66)
      • variant (68)
    • PDB 1QKK (142-End)
    Domains in SCOPe 2.07: d1qkka1, d1qkka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qkkA (A:)
    saapsvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgm
    dglalfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraee
    krrlvmenrslrraaeaaseglklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkkA (A:)
    psvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgmdgl
    alfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraeekrr
    lvmenrslrraaeaaseglk