PDB entry 1qkj

View 1qkj on RCSB PDB site
Description: T4 Phage B-Glucosyltransferase, Substrate Binding and Proposed Catalytic Mechanism
Class: transferase (glucosyltransferase)
Keywords: transferase (glucosyltransferase), transferase(glucosyltransferase)
Deposited on 1999-07-22, released 1999-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosyltransferase
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qkja_
  • Heterogens: UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkjA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl