PDB entry 1qkc

View 1qkc on RCSB PDB site
Description: escherichia coli ferric hydroxamate uptake receptor (fhua) in complex delta two-albomycin
Deposited on 1999-07-18, released 2000-06-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-05, with a file datestamp of 2000-06-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.222
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qkca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkcA (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
    kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
    ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
    nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
    qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
    rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf