PDB entry 1qkc

View 1qkc on RCSB PDB site
Description: escherichia coli ferric hydroxamate uptake receptor (fhua) in complex delta two-albomycin
Class: tonb dependent receptor
Keywords: tonb dependent receptor, tonb-dependent receptor, integral outer membrane protein, ferrichrome, siderophore receptor, antibiotic, albomycin, active transporter, iron transport protein
Deposited on 1999-07-18, released 2000-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric hydroxamate receptor
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: fhuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06971 (416-724)
      • insertion (405-415)
    Domains in SCOPe 2.08: d1qkca_
  • Heterogens: FTT, DPO, PO4, NI, ALB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qkcA (A:)
    avepkedtitvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemal
    hqpksvkealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndav
    idpymleraeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdf
    sdsldddgvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepe
    tgyygwlpkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnl
    rfaenktsqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtq
    lqskfatgdidhtlltgvdfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntd
    fdfnakdpansgpyrilnkqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttd
    krddkqftwrggvnylfdngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvp
    edrpivvtgavynltktnnlmadpegsffsveggeirargveieakaalsasvnvvgsyt
    ytdaeyttdttykgntpaqvpkhmaslwadytffdgplsgltlgtggrytgssygdpans
    fkvgsytvvdalvrydlarvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvat
    atfrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkcA (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
    kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
    ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
    nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
    qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
    rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf