PDB entry 1qk9

View 1qk9 on RCSB PDB site
Description: the solution structure of the domain from mecp2 that binds to methylated DNA
Class: methyl-cpg-binding protein
Keywords: methyl-cpg-binding protein, nmr, solution structure, methylated DNA, methyl cytosine, mbd
Deposited on 1999-07-12, released 1999-10-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methyl-cpg-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51608 (0-91)
    • conflict (88)
    • conflict (90-91)
  Domains in SCOPe 2.03: d1qk9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qk9A (A:)
  asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
  eliayfekvgdtsldpndfdftvtgrgsgsgc