PDB entry 1qk9

View 1qk9 on RCSB PDB site
Description: the solution structure of the domain from mecp2 that binds to methylated DNA
Class: methyl-cpg-binding protein
Keywords: nmr, solution structure, methylated DNA, methyl cytosine, mbd
Deposited on 1999-07-12, released 1999-10-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR28
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methyl-cpg-binding protein 2
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51608 (0-89)
    • conflict (88)
  Domains in SCOP 1.75: d1qk9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qk9A (A:)
  asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
  eliayfekvgdtsldpndfdftvtgrgsgsgc