PDB entry 1qk9

View 1qk9 on RCSB PDB site
Description: the solution structure of the domain from mecp2 that binds to methylated dna
Deposited on 1999-07-12, released 1999-10-08
The last revision prior to the SCOP 1.69 freeze date was dated 1999-10-08, with a file datestamp of 1999-10-07.
Experiment type: NMR28
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qk9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qk9A (A:)
    asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
    eliayfekvgdtsldpndfdftvtgrgsgsgc