PDB entry 1qk9

View 1qk9 on RCSB PDB site
Description: the solution structure of the domain from mecp2 that binds to methylated dna
Deposited on 1999-07-12, released 1999-10-08
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-08, with a file datestamp of 1999-10-07.
Experiment type: NMR28
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1qk9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qk9A (A:)
  asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
  eliayfekvgdtsldpndfdftvtgrgsgsgc