PDB entry 1qk9

View 1qk9 on RCSB PDB site
Description: The solution structure of the domain from MeCP2 that binds to methylated DNA
Class: methyl-cpg-binding protein
Keywords: methyl-cpg-binding protein, solution structure, methylated DNA, methyl cytosine, mbd
Deposited on 1999-07-12, released 1999-10-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-cpg-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51608 (0-91)
      • conflict (88)
      • conflict (90-91)
    Domains in SCOPe 2.08: d1qk9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qk9A (A:)
    asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
    eliayfekvgdtsldpndfdftvtgrgsgsgc