PDB entry 1qk3

View 1qk3 on RCSB PDB site
Description: toxoplasma gondii hypoxanthine-guanine phosphoribosyltransferase gmp complex
Class: transferase
Keywords: transferase, glycosyltransferase, purine salvage
Deposited on 1999-07-09, released 1999-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.202
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QK3
    • Uniprot Q26997 (3-End)
    Domains in SCOPe 2.06: d1qk3a_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QK3
    • Uniprot Q26997 (3-End)
    Domains in SCOPe 2.06: d1qk3b1, d1qk3b2
  • Chain 'C':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QK3
    • Uniprot Q26997 (3-End)
    Domains in SCOPe 2.06: d1qk3c1, d1qk3c2
  • Chain 'D':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QK3
    • Uniprot Q26997 (3-End)
    Domains in SCOPe 2.06: d1qk3d_
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qk3A (A:)
    gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
    klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks
    yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve
    krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qk3A (A:)
    maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
    ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
    dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
    drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qk3B (B:)
    gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
    klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks
    yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve
    krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qk3B (B:)
    gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
    klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks
    yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve
    krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qk3C (C:)
    gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
    klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks
    yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve
    krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qk3C (C:)
    gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
    klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrldl
    sifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrslkgdfvgfsie
    dvwivgccydfnemfrdfdhvavlsdaarkkfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qk3D (D:)
    gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
    klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks
    yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve
    krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qk3D (D:)
    maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
    ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
    dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
    drslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfe