PDB entry 1qk2

View 1qk2 on RCSB PDB site
Description: wild type cel6a with a non-hydrolysable cellotetraose
Deposited on 1999-07-09, released 1999-09-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-18, with a file datestamp of 1999-09-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qk2a_
  • Chain 'B':
    Domains in SCOP 1.55: d1qk2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qk2A (A:)
    tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
    meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
    ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
    ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
    neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
    dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
    sfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qk2B (B:)
    tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
    meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
    ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
    ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
    neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
    dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
    sfl