PDB entry 1qk0

View 1qk0 on RCSB PDB site
Description: cel6a with a non-hydrolysable cellotetraose
Deposited on 1999-07-08, released 1999-09-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-18, with a file datestamp of 1999-09-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qk0a_
  • Chain 'B':
    Domains in SCOP 1.55: d1qk0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qk0A (A:)
    tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
    meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
    ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
    ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
    neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
    dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
    sfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qk0B (B:)
    tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
    meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
    ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
    ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
    neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
    dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
    sfl