PDB entry 1qjw

View 1qjw on RCSB PDB site
Description: cel6a (y169f) with a non-hydrolysable cellotetraose
Deposited on 1999-07-06, released 1999-09-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-18, with a file datestamp of 1999-09-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qjwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1qjwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjwA (A:)
    atysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktplm
    eqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidtirqi
    vveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamyldag
    hagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavyn
    eklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantgd
    slldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanps
    fl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjwB (B:)
    atysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktplm
    eqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidtirqi
    vveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamyldag
    hagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavyn
    eklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantgd
    slldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanps
    fl