PDB entry 1qjv

View 1qjv on RCSB PDB site
Description: pectin methylesterase pema from erwinia chrysanthemi
Deposited on 1999-07-05, released 2000-07-14
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-27, with a file datestamp of 2001-03-27.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qjva_
  • Chain 'B':
    Domains in SCOP 1.67: d1qjvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjvA (A:)
    attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
    srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
    dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
    gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
    lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
    ffeyksygagaavskdrrqltdaqaaeytqskvlgdwtptlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjvB (B:)
    attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
    srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
    dsskikdtqavalyvtksgdrayfkdvslvgyqdtlyvsggrsffsdcrisgtvdfifgd
    gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
    lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
    ffeyksygagaavskdrrqltdaqaaeytqskvlgdwtptlp