PDB entry 1qjt

View 1qjt on RCSB PDB site
Description: solution structure of the apo eh1 domain of mouse epidermal growth factor receptor substrate 15, eps15
Deposited on 1999-07-02, released 2000-01-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-23, with a file datestamp of 2000-01-22.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qjta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjtA (A:)
    lsltqlssgnpvyekyyrqveagntgrvlaldaaaflkksglpdlilgkiwdladtdgkg
    vlskqeffvalrlvacaqnglevslsslslavppprfhd