PDB entry 1qjq

View 1qjq on RCSB PDB site
Description: ferric hydroxamate receptor from escherichia coli (fhua)
Class: tonb dependent receptor
Keywords: tonb dependent receptor, lipopolysaccharide, ferrichrome-iron receptor, integral outer membrane protein, tonb-dependent receptor, siderophore receptor, active transport, iron transport, siderophore-antibiotic conjugate
Deposited on 1999-06-29, released 2000-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric hydroxamate receptor
    Species: ESCHERICHIA COLI [TaxId:83333]
    Gene: fhuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06971 (416-724)
      • insertion (405-415)
    Domains in SCOPe 2.08: d1qjqa_
  • Heterogens: FTT, DPO, PO4, NI, PFC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjqA (A:)
    avepkedtitvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemal
    hqpksvkealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndav
    idpymleraeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdf
    sdsldddgvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepe
    tgyygwlpkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnl
    rfaenktsqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtq
    lqskfatgdidhtlltgvdfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntd
    fdfnakdpansgpyrilnkqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttd
    krddkqftwrggvnylfdngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvp
    edrpivvtgavynltktnnlmadpegsffsveggeirargveieakaalsasvnvvgsyt
    ytdaeyttdttykgntpaqvpkhmaslwadytffdgplsgltlgtggrytgssygdpans
    fkvgsytvvdalvrydlarvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvat
    atfrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjqA (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
    kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
    ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
    nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
    qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
    rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf