PDB entry 1qjp

View 1qjp on RCSB PDB site
Description: high resolution structure of the outer membrane protein a (ompa) transmembrane domain
Class: outer membrane
Keywords: outer membrane
Deposited on 1999-06-29, released 2000-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein a
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: OMPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02934 (0-170)
      • engineered mutation (33)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d1qjpa_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjpA (A:)
    apkdntwytgaklgwsqyhdtgfinnngpthenklgagafggyqvnpyvgfemgydwlgr
    mpykgsvengaykaqgvqltaklgypitddldiytrlggmvwradtysnvygknhdtgvs
    pvfaggveyaitpeiatrleyqwtnnigdahtigtrpdngmlslgvsyrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjpA (A:)
    apkdntwytgaklgwsqhenklgagafggyqvnpyvgfemgydwlgrmpyaykaqgvqlt
    aklgypitddldiytrlggmvwradtysnvygknhdtgvspvfaggveyaitpeiatrle
    yqwtngmlslgvsyrfg