PDB entry 1qjh

View 1qjh on RCSB PDB site
Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Deposited on 1999-06-24, released 2000-06-29
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-04, with a file datestamp of 2000-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qjha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjhA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjhA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvks