PDB entry 1qjh

View 1qjh on RCSB PDB site
Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Deposited on 1999-06-24, released 2000-06-29
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-04, with a file datestamp of 2000-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: -1.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1qjha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qjhA (A:)
  mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
  lwyqvempedrvndlarelrirdnvrrvmvvks