PDB entry 1qjf

View 1qjf on RCSB PDB site
Description: isopenicillin n synthase from aspergillus nidulans (monocyclic sulfoxide - fe complex)
Deposited on 1999-06-23, released 2000-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-29, with a file datestamp of 2000-06-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1312
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qjfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjfA (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjfA (A:)
    vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
    sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
    hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
    vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
    addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
    gksdreplsygdylqnglvslinkngqt