PDB entry 1qje

View 1qje on RCSB PDB site
Description: isopenicillin n synthase from aspergillus nidulans (ip1 - fe complex)
Deposited on 1999-06-23, released 2000-06-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-29, with a file datestamp of 2000-06-29.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.1309
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qjea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjeA (A:)
    skanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhms
    itpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpth
    evnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlasv
    vlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdiea
    ddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepng
    ksdreplsygdylqnglvslinkngqt