PDB entry 1qja

View 1qja on RCSB PDB site
Description: 14-3-3 zeta/phosphopeptide complex (mode 2)
Deposited on 1999-06-23, released 1999-09-15
The last revision prior to the SCOP 1.59 freeze date was dated 1999-09-15, with a file datestamp of 1999-09-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qjaa_
  • Chain 'B':
    Domains in SCOP 1.59: d1qjab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjaA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjaA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqmareyrekietelrdicndvlsllekflipnasqaeskvfylkmkgdyyryla
    evadkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnspekacslak
    tafdeaiaeldtlseesykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qjaB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjaB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevakkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilns
    pekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt