PDB entry 1qj4

View 1qj4 on RCSB PDB site
Description: hydroxynitrile-lyase from hevea brasiliensis at atomic resolution
Class: lyase
Keywords: oxynitrilase, cyanogenesis, cyanhydrin formation, lyase
Deposited on 1999-06-21, released 1999-10-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1158
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxynitrile lyase
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: HNL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qj4a_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qj4A (A:)
    mafahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysep
    lltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdk
    lmevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfq
    nilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqlt
    ktkeiaeilqevadtyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj4A (A:)
    afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
    ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
    mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
    ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
    tkeiaeilqevadtyn