PDB entry 1qj4

View 1qj4 on RCSB PDB site
Description: hydroxynitrile-lyase from hevea brasiliensis at atomic resolution
Deposited on 1999-06-21, released 1999-10-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1158
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qj4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qj4A (A:)
    mafahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysep
    lltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdk
    lmevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfq
    nilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqlt
    ktkeiaeilqevadtyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj4A (A:)
    afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
    ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
    mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
    ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
    tkeiaeilqevadtyn