PDB entry 1qj3

View 1qj3 on RCSB PDB site
Description: Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid
Class: transferase
Keywords: transferase, aminotransferase, pyridoxal-5'-phosphate, biotin biosynthesis
Deposited on 1999-06-21, released 2000-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-diaminopelargonic acid synthase
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: bioA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • conflict (13)
    Domains in SCOPe 2.08: d1qj3a_
  • Chain 'B':
    Compound: 7,8-diaminopelargonic acid synthase
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: bioA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • conflict (13)
    Domains in SCOPe 2.08: d1qj3b_
  • Heterogens: PLP, KAP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qj3A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj3A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnlpenlfapapqsrmgewderd
    mvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregilliadeiatg
    fgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnggcfmhgptfmg
    nplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrvlgaigvvetth
    pvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnravqdetffc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qj3B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj3B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnlpenlfapapqsrmewderdm
    vgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregilliadeiatgf
    grtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnggcfmhgptfmgn
    placaaanaslailesgdwqqqvadievqlreqlapardaemvadvrvlgaigvvetthp
    vnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnravqdetffc