PDB entry 1qj2

View 1qj2 on RCSB PDB site
Description: co dehydrogenase from oligotropha carboxidovorans
Class: oxidoreductase
Keywords: molybdenum hydroxylase
Deposited on 1999-06-21, released 1999-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-06-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon monoxide dehydrogenase
    Species: PSEUDOMONAS CARBOXYDOVORANS
    Database cross-references and differences (RAF-indexed):
    • PIR B56279
    Domains in SCOPe 2.07: d1qj2a3, d1qj2a4
  • Chain 'B':
    Compound: carbon monoxide dehydrogenase
    Species: PSEUDOMONAS CARBOXYDOVORANS
    Database cross-references and differences (RAF-indexed):
    • PIR C56279 (Start-808)
      • conflict (387)
      • conflict (669)
      • conflict (34)
    Domains in SCOPe 2.07: d1qj2b3, d1qj2b4
  • Chain 'C':
    Compound: carbon monoxide dehydrogenase
    Species: PSEUDOMONAS CARBOXYDOVORANS
    Database cross-references and differences (RAF-indexed):
    • PIR A56279 (0-284)
    Domains in SCOPe 2.07: d1qj2c3, d1qj2c4
  • Chain 'G':
    Compound: carbon monoxide dehydrogenase
    Species: PSEUDOMONAS CARBOXYDOVORANS
    Database cross-references and differences (RAF-indexed):
    • PIR B56279
    Domains in SCOPe 2.07: d1qj2g3, d1qj2g4
  • Chain 'H':
    Compound: carbon monoxide dehydrogenase
    Species: PSEUDOMONAS CARBOXYDOVORANS
    Domains in SCOPe 2.07: d1qj2h3, d1qj2h4
  • Chain 'I':
    Compound: carbon monoxide dehydrogenase
    Species: PSEUDOMONAS CARBOXYDOVORANS
    Database cross-references and differences (RAF-indexed):
    • PIR A56279 (0-284)
    Domains in SCOPe 2.07: d1qj2i3, d1qj2i4
  • Heterogens: FAD, FES, PCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qj2A (A:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj2A (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qj2B (B:)
    mniqttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrxsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdididtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj2B (B:)
    tsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidt
    skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
    adaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdk
    egtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvv
    slisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlstts
    fardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvah
    lavdgvytnkasggvayrxsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfp
    ymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisfftei
    vgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipad
    dimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewd
    vdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdid
    idtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfm
    dfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghi
    qmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakar
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qj2G (G:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj2G (G:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qj2H (H:)
    mniqttveptsaeraeklqgmgckrkrvedirftegkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrxsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdididtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qj2H (H:)
    tsaeraeklqgmgckrkrvedirftegkgnyvddvklpgmlfgdfvrsshahariksidt
    skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
    adaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdk
    egtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvv
    slisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlstts
    fardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvah
    lavdgvytnkasggvayrxsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfp
    ymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisfftei
    vgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipad
    dimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewd
    vdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdid
    idtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfm
    dfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghi
    qmphdawrlwkvgeqlglhv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2I (I:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakar