PDB entry 1qiy

View 1qiy on RCSB PDB site
Description: human insulin hexamers with chain b his mutated to tyr complexed with phenol
Class: hormone
Keywords: hormone, glucose metabolism, diabetes, insulin mutant
Deposited on 1999-06-18, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1qiy.1
• Chain 'B':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d1qiy.1
• Chain 'C':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1qiy.2
• Chain 'D':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d1qiy.2
• Chain 'E':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1qiy.3
• Chain 'F':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d1qiy.3
• Chain 'G':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1qiy.4
• Chain 'H':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d1qiy.4
• Chain 'I':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1qiy.5
• Chain 'J':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d1qiy.5
• Chain 'K':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1qiy.6
• Chain 'L':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d1qiy.6
• Heterogens: IPH, ZN, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyB (B:)
  fvnqylcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyD (D:)
  fvnqylcgshlvealylvcgergffytpkt
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyF (F:)
  fvnqylcgshlvealylvcgergffytpkt
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyG (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyH (H:)
  fvnqylcgshlvealylvcgergffytpkt
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyI (I:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyJ (J:)
  fvnqylcgshlvealylvcgergffytpkt
  

  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyK (K:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qiyL (L:)
  fvnqylcgshlvealylvcgergffytpkt