PDB entry 1qi7

View 1qi7 on RCSB PDB site
Description: the crystal structure at 2.0 a of saporin so6, a ribosome inactivating protein from saponaria officinalis
Class: hydrolase
Keywords: ribosome inactivating protein, n-glycosidase, hydrolase
Deposited on 1999-06-08, released 2000-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (n-glycosidase)
    Species: Saponaria officinalis [TaxId:3572]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qi7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qi7A (A:)
vtsitldlvnptagqyssfvdkirnnvkdpnlkyggtdiavigppskekflrinfqssrg
tvslglkrdnlyvvaylamdntnvnrayyfkseitsaeltalfpeattanqkaleytedy
qsieknaqitqgdksrkelglgidllltfmeavnkkarvvknearflliaiqmtaevarf
ryiqnlvtknfpnkfdsdnkviqfevswrkistaiygdakngvfnkdydfgfgkvrqvkd
lqmgllmylgkpk