PDB entry 1qi5

View 1qi5 on RCSB PDB site
Description: mutant (d294n) maltotetraose-forming exo-amylase in complex with maltotetraose
Class: hydrolase
Keywords: hydrolase, maltotetraose-forming exo amylase
Deposited on 1999-06-03, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (exo-maltotetraohydrolase)
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13507 (0-417)
      • engineered (293)
    Domains in SCOPe 2.07: d1qi5a1, d1qi5a2
  • Heterogens: CA, MTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qi5A (A:)
    dqagkspnavryhggdeiilqgfhwnvvreapndwynilrqqaatiaadgfsaiwmpvpw
    rdfsswsdgsksgggegyfwhdfnkngrygsdaqlrqaasalggagvkvlydvvpnhmnr
    gypdkeinlpagqgfwrndcadpgnypndcddgdrfiggdadlntghpqvygmfrdeftn
    lrsqygaggfrfdfvrgyapervnswmtdsadnsfcvgelwkgpseypnwdwrntaswqq
    iikdwsdrakcpvfdfalkermqngsiadwkhglngnpdprwrevavtfvdnhntgyspg
    qnggqhhwalqdglirqayayiltspgtpvvywdhmydwgygdfirqliqvrraagvrad
    saisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwrsgt
    gsgggepga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qi5A (A:)
    dqagkspnavryhggdeiilqgfhwnvvreapndwynilrqqaatiaadgfsaiwmpvpw
    rdfsswsdgsksgggegyfwhdfnkngrygsdaqlrqaasalggagvkvlydvvpnhmnr
    gypdkeinlpagqgfwrndcadpgnypndcddgdrfiggdadlntghpqvygmfrdeftn
    lrsqygaggfrfdfvrgyapervnswmtdsadnsfcvgelwkgpseypnwdwrntaswqq
    iikdwsdrakcpvfdfalkermqngsiadwkhglngnpdprwrevavtfvdnhntgyspg
    qnggqhhwalqdglirqayayiltspgtpvvywdhmydwgygdfirqliqvrraagvrad
    saisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwrs