PDB entry 1qi2

View 1qi2 on RCSB PDB site
Description: endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with 2',4'-dinitrophenyl 2-deoxy-2-fluoro-b-d-cellotrioside
Class: hydrolase
Keywords: hydrolase, cellulose degradation, endoglucanase, glycoshydrolase family 5
Deposited on 1999-06-02, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase b
    Species: Bacillus agaradhaerens [TaxId:76935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qi2a_
  • Heterogens: CA, FCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qi2A (A:)
    dndsvveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginv
    fraamytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffd
    emselygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsq
    dvhhaadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggv
    fldeaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvreki
    resas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qi2A (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
    as