PDB entry 1qhw

View 1qhw on RCSB PDB site
Description: purple acid phosphatase from rat bone
Class: hydrolase
Keywords: metal phosphatase, hydrolase
Deposited on 1999-03-26, released 1999-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (purple acid phosphatase)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ACP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qhwa_
  • Heterogens: FE, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qhwA (A:)
    mdtwmvllglqilllpllahctapastlrfvavgdwggvpnapfhtaremanakeiartv
    qimgadfimslgdnfyftgvhdandkrfqetfedvfsdralrnipwyvlagnhdhlgnvs
    aqiayskiskrwnfpspyyrlrfkvprsnitvaifmldtvmlcgnsddfvsqqpemprdl
    gvartqlswlkkqlaaakedyvlvaghypiwsiaehgptrclvknlrpllaaygvtaylc
    ghdhnlqylqdengvgyvlsgagnfmdpsvrhqrkvpngylrfhygsedslggftyveig
    skemsityveasgkslfktslprrprp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qhwA (A:)
    stlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvhdand
    krfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrfkv
    prsnitvaifmldtvmlcgnsddfvsqqpemprdlgvartqlswlkkqlaaakedyvlva
    ghypiwsiaehgptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsgagnf
    mdpsvrhqrkvpngylrfhygsedslggftyveigskemsityveasgkslfktslprrp