PDB entry 1qhw

View 1qhw on RCSB PDB site
Description: purple acid phosphatase from rat bone
Deposited on 1999-03-26, released 1999-09-15
The last revision prior to the SCOP 1.59 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qhwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhwA (A:)
    stlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvhdand
    krfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrfkv
    prsnitvaifmldtvmlcgnsddfvsqqpemprdlgvartqlswlkkqlaaakedyvlva
    ghypiwsiaehgptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsgagnf
    mdpsvrhqrkvpngylrfhygsedslggftyveigskemsityveasgkslfktslprrp