PDB entry 1qhs

View 1qhs on RCSB PDB site
Description: chloramphenicol phosphotransferase in complex with chloramphenicol from streptomyces venezuelae
Class: transferase
Keywords: kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold, transferase
Deposited on 1999-05-27, released 2000-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chloramphenicol phosphotransferase)
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qhsa_
  • Heterogens: SO4, CLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhsA (A:)
    mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
    gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
    cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp