PDB entry 1qhq

View 1qhq on RCSB PDB site
Description: auracyanin, a blue copper protein from the green thermophilic photosynthetic bacterium chloroflexus aurantiacus
Deposited on 1999-05-25, released 2001-03-07
The last revision prior to the SCOP 1.61 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.198
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1qhqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qhqA (A:)
  anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl
  vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi
  ctfpghylagmkgtltvtp