PDB entry 1qho

View 1qho on RCSB PDB site
Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex
Class: hydrolase
Keywords: amylase, glycoside hydrolase, starch degradation
Deposited on 1999-05-25, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.151
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19531 (0-685)
      • conflict (see remark 999) (75)
      • insertion (see remark 999) (220-222)
      • conflict (see remark 999) (345)
      • conflict (see remark 999) (347)
      • conflict (see remark 999) (349)
      • insertion (see remark 999) (351-352)
      • conflict (see remark 999) (355)
      • conflict (see remark 999) (357)
    Domains in SCOPe 2.07: d1qhoa1, d1qhoa2, d1qhoa3, d1qhoa4
  • Heterogens: MAL, ABD, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhoA (A:)
    sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy
    lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn
    gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr
    yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks
    ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt
    mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy
    ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqygtttqrwinndvy
    iyerkffndvvlvainrntqssysisglqtalpngsyadylsgllggngisvsngsvasf
    tlapgavsvwqystsasapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvks
    wtsnrievyvpnmaagltdvkvtaggvssnlysynilsgtqtsvvftvksapptnlgdki
    yltgnipelgnwstdtsgavnnaqgpllapnypdwfyvfsvpagktiqfkffikradgti
    qwengsnhvattptgatgnitvtwqn