PDB entry 1qhf

View 1qhf on RCSB PDB site
Description: yeast phosphoglycerate mutase-3pg complex structure to 1.7 a
Deposited on 1999-05-13, released 1999-06-10
The last revision prior to the SCOP 1.59 freeze date was dated 2000-01-13, with a file datestamp of 2000-01-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qhfa_
  • Chain 'B':
    Domains in SCOP 1.59: d1qhfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhfA (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhfB (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav