PDB entry 1qhe

View 1qhe on RCSB PDB site
Description: energetics of a hydrogen bond (charged and neutral) and of a cation-pi interaction in apoflavodoxin
Class: electron transport
Keywords: flavodoxin, electron transport
Deposited on 1999-05-12, released 1999-05-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (flavodoxin)
  Species: NOSTOC SP. [TaxId:1168]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A3E0 (0-167)
  Domains in SCOPe 2.03: d1qhea_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qheA (A:)
  kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
  lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
  tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl