PDB entry 1qhe

View 1qhe on RCSB PDB site
Description: energetics of a hydrogen bond (charged and neutral) and of a cation-pi interaction in apoflavodoxin
Class: electron transport
Keywords: flavodoxin, electron transport
Deposited on 1999-05-12, released 1999-05-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (flavodoxin)
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1qhea_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qheA (A:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl