PDB entry 1qh8

View 1qh8 on RCSB PDB site
Description:
Deposited on 1999-05-11, released 1999-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 1999-11-01, with a file datestamp of 1999-10-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.155
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh8a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh8b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh8c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh8d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh8A (A:)
    tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
    cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
    divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
    rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
    eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
    tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
    vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
    sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh8B (B:)
    sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
    tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
    avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
    hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
    eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
    vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
    kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
    cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
    wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh8C (C:)
    tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
    cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
    divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
    rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
    eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
    tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
    vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
    sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh8D (D:)
    sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
    tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
    avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
    hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
    eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
    vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
    kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
    cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
    wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr