PDB entry 1qh1

View 1qh1 on RCSB PDB site
Description:
Deposited on 1999-05-10, released 1999-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 1999-11-04, with a file datestamp of 1999-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.158
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh1a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh1b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh1c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qh1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh1A (A:)
    tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
    cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
    divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
    rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
    eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
    tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
    vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
    sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh1B (B:)
    sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
    tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
    avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
    hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
    eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
    vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
    kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
    cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
    wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh1C (C:)
    tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
    cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
    divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
    rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
    eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
    tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
    vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
    sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qh1D (D:)
    sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
    tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
    avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
    hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
    eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
    vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
    kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
    cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
    wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr