PDB entry 1qgr

View 1qgr on RCSB PDB site
Description: structure of importin beta bound to the ibb domain of importin alpha (II crystal form, grown at low ph)
Class: transport receptor
Keywords: transport receptor, nuclear import, heat motif, nls-binding
Deposited on 1999-05-04, released 1999-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (importin beta subunit)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qgra_
  • Chain 'B':
    Compound: protein (importin alpha-2 subunit)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qgrA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlarwatkelrklknqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qgrA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqsggvqedalmavstlvevlggeflkymeafkpflgiglknyaey
    qvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialai
    ggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqenvh
    pdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpmih
    elltegrrsktnkaktlarwatkelrklknqa
    

  • Chain 'B':
    No sequence available.