PDB entry 1qgi

View 1qgi on RCSB PDB site
Description: chitosanase from bacillus circulans
Deposited on 1999-04-28, released 1999-10-25
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qgia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgiA (A:)
    aspddnfspetlqflrnntgldgeqwnnimklinkpeqddlnwikyygycediedergyt
    iglfgattggsrdthpdgpdlfkaydaakgasnpsadgalkrlgingkmkgsileikdse
    kvfcgkikklqndaawrkamwetfynvyirysveqarqrgftsavtigsfvdtalnqgat
    ggsdtlqgllarsgsssnektfmknfhakrtlvvdtnkynkppngknrvkqwdtlvdmgk
    mnlknvdseiaqvtdwemk