PDB entry 1qgi

View 1qgi on RCSB PDB site
Description: chitosanase from bacillus circulans
Class: hydrolase
Keywords: hydrolase, chitosan degradation
Deposited on 1999-04-28, released 1999-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chitosanase)
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33673 (0-258)
      • cloning artifact (76-77)
      • cloning artifact (79)
      • cloning artifact (81)
      • cloning artifact (97)
      • cloning artifact (157)
      • insertion (158)
      • cloning artifact (159)
    Domains in SCOPe 2.08: d1qgia_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qgiA (A:)
aspddnfspetlqflrnntgldgeqwnnimklinkpeqddlnwikyygycediedergyt
iglfgattggsrdthpdgpdlfkaydaakgasnpsadgalkrlgingkmkgsileikdse
kvfcgkikklqndaawrkamwetfynvyirysveqarqrgftsavtigsfvdtalnqgat
ggsdtlqgllarsgsssnektfmknfhakrtlvvdtnkynkppngknrvkqwdtlvdmgk
mnlknvdseiaqvtdwemk