PDB entry 1qgh

View 1qgh on RCSB PDB site
Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.
Deposited on 1999-04-27, released 2000-01-14
The last revision prior to the SCOP 1.69 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.219
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qgha_
  • Chain 'B':
    Domains in SCOP 1.69: d1qghb_
  • Chain 'C':
    Domains in SCOP 1.69: d1qghc_
  • Chain 'D':
    Domains in SCOP 1.69: d1qghd_
  • Chain 'E':
    Domains in SCOP 1.69: d1qghe_
  • Chain 'F':
    Domains in SCOP 1.69: d1qghf_
  • Chain 'G':
    Domains in SCOP 1.69: d1qghg_
  • Chain 'H':
    Domains in SCOP 1.69: d1qghh_
  • Chain 'I':
    Domains in SCOP 1.69: d1qghi_
  • Chain 'J':
    Domains in SCOP 1.69: d1qghj_
  • Chain 'K':
    Domains in SCOP 1.69: d1qghk_
  • Chain 'L':
    Domains in SCOP 1.69: d1qghl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qghA (A:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghA (A:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qghB (B:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghB (B:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qghC (C:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghC (C:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qghD (D:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghD (D:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qghE (E:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghE (E:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qghF (F:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghF (F:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qghG (G:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghG (G:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qghH (H:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghH (H:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1qghI (I:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghI (I:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1qghJ (J:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghJ (J:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1qghK (K:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghK (K:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1qghL (L:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qghL (L:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple