PDB entry 1qgd

View 1qgd on RCSB PDB site
Description: transketolase from escherichia coli
Class: transferase
Keywords: thiamine pyrophosphate, d-sedoheptulose 7-phosphate d-glyceraldehyde 3- phosphate glycolaldehyde transferase, transferase
Deposited on 1999-04-23, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.132
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transketolase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (0-661)
      • see remark 999 (103)
      • see remark 999 (484)
    Domains in SCOPe 2.07: d1qgda1, d1qgda2, d1qgda3
  • Chain 'B':
    Compound: protein (transketolase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (0-661)
      • see remark 999 (103)
      • see remark 999 (484)
    Domains in SCOPe 2.07: d1qgdb1, d1qgdb2, d1qgdb3
  • Heterogens: CA, SO4, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgdA (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgktagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    ll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgdB (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgktagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    ll