PDB entry 1qgb

View 1qgb on RCSB PDB site
Description: solution structure of the n-terminal f1 module pair from human fibronectin
Class: cell adhesion
Keywords: fibronectin type 1 module pair, cell adhesion
Deposited on 1999-04-21, released 1999-12-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fibronectin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qgba1, d1qgba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qgbA (A:)
    skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskpeaeetcfdkytgntyr
    vgdtyerpkdsmiwdctcigagrgrisctianr