PDB entry 1qg7

View 1qg7 on RCSB PDB site
Description: stroma cell-derived factor-1alpha (sdf-1alpha)
Class: cytokine
Keywords: cxc-chemokine
Deposited on 1999-04-21, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromal cell-derived factor 1 alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qg7a_
  • Chain 'B':
    Compound: stromal cell-derived factor 1 alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qg7b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qg7A (A:)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qg7A (A:)
    syrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeyleka
    ln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qg7B (B:)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qg7B (B:)
    pvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqey
    lekaln