PDB entry 1qg7

View 1qg7 on RCSB PDB site
Description: stroma cell-derived factor-1alpha (sdf-1alpha)
Deposited on 1999-04-21, released 2001-02-28
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qg7a_
  • Chain 'B':
    Domains in SCOP 1.57: d1qg7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qg7A (A:)
    syrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeyleka
    ln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qg7B (B:)
    pvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqey
    lekaln